A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10061
Swiss-prot Accession number	Q7M427 (Sequence in FASTA format)
Description	Egg-laying hormone (ELH).
Source organism	Aplysia brasiliana (Mottled sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string
Protein Length	36 Amino acids
Molecular weight	4385
References	1  PubMed abstract 3226961
Domain Name	N/A
Hormone Name	Egg-laying hormone
Mature Hormone Sequence	ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10609
Swiss-prot Accession number	P01362 (Sequence in FASTA format)
Description	ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia californica (California sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string
Protein Length	271 Amino acids
Molecular weight	30827
References	1  PubMed abstract 6687446 2  PubMed abstract 16593372 3  PubMed abstract 293751 4  PubMed abstract 3549995
Domain Name	ELH
Hormone Name	Egg-laying hormone
Mature Hormone Sequence	ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK
Position of mature hormone in Pre-Hormone protein	36 Residues from position (206-241)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10612
Swiss-prot Accession number	P17685 (Sequence in FASTA format)
Description	ELH type 1 precursor [Contains: Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide].
Source organism	Aplysia parvula (Little sea hare)
Taxonomical Classification	Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the molluscan ELH family.
Tissue Specificity	Bag cell neurons
Post translational modification	N/A
Function	ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string
Protein Length	263 Amino acids
Molecular weight	29676
References	1  PubMed abstract 3734873
Domain Name	ELH
Hormone Name	Egg-laying hormone
Mature Hormone Sequence	ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK
Position of mature hormone in Pre-Hormone protein	36 Residues from position (198-233)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated