A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10061 |
Swiss-prot Accession number | Q7M427 (Sequence in FASTA format) |
Description | Egg-laying hormone (ELH). |
Source organism | Aplysia brasiliana (Mottled sea hare) |
Taxonomical Classification | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the molluscan ELH family. |
Tissue Specificity | Bag cell neurons |
Post translational modification | N/A |
Function | ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string |
Protein Length | 36 Amino acids |
Molecular weight | 4385 |
References | 1 PubMed abstract 3226961 |
Domain Name | N/A |
Hormone Name | Egg-laying hormone |
Mature Hormone Sequence | ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10609 |
Swiss-prot Accession number | P01362 (Sequence in FASTA format) |
Description | ELH precursor [Contains: Alpha-bag cell peptide (Alpha-BCP); Beta-bagcell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP); Egg-laying hormone (ELH); Acidic peptide]. |
Source organism | Aplysia californica (California sea hare) |
Taxonomical Classification | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the molluscan ELH family. |
Tissue Specificity | Bag cell neurons |
Post translational modification | N/A |
Function | ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string |
Protein Length | 271 Amino acids |
Molecular weight | 30827 |
References | 1 PubMed abstract 6687446 2 PubMed abstract 16593372 3 PubMed abstract 293751 4 PubMed abstract 3549995 |
Domain Name | ELH |
Hormone Name | Egg-laying hormone |
Mature Hormone Sequence | ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (206-241) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10612 |
Swiss-prot Accession number | P17685 (Sequence in FASTA format) |
Description | ELH type 1 precursor [Contains: Alpha-bag cell peptide (Alpha-BCP);Beta-bag cell peptide (Beta-BCP); Gamma-bag cell peptide (Gamma-BCP);Egg-laying hormone (ELH); Acidic peptide]. |
Source organism | Aplysia parvula (Little sea hare) |
Taxonomical Classification | Eukaryota; Metazoa; Mollusca; Gastropoda; Orthogastropoda;Apogastropoda; Heterobranchia; Euthyneura; Opisthobranchia; Anaspidea;Aplysioidea; Aplysiidae; Aplysia. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the molluscan ELH family. |
Tissue Specificity | Bag cell neurons |
Post translational modification | N/A |
Function | ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string |
Protein Length | 263 Amino acids |
Molecular weight | 29676 |
References | 1 PubMed abstract 3734873 |
Domain Name | ELH |
Hormone Name | Egg-laying hormone |
Mature Hormone Sequence | ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (198-233) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |